PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03244.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GRAS
Protein Properties Length: 577aa    MW: 63499.5 Da    PI: 5.8901
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03244.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS308.21.9e-942085742374
                     GRAS   2 velLlecAeavss.gdlelaqalLarlsel.aspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklf 84 
                              +e+L+++Ae+++s gd+ laq +Larl+++ +sp++ +p++R+a+yf eAL++ l+++ +   ++ +    ++++ + +++a+k f
  Rsa1.0_03244.1_g00001.1 208 TEQLFKVAEVIESgGDTCLAQGILARLNQQlSSPAAgKPFERAASYFIEALHSCLLHHNN---ATQQQPLLNPYSLIFKISAYKSF 290
                              789*********978999**********998777766*******************9333...333455555677*********** PP

                     GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRp.....egpp.slRiTgvgspesgskeeleetge 163
                              se+sP+l+f+++t Nqa+le+++g +r+HiiDfdi+ G+QW++L+q+L   R+     ++ p sl+iT ++s ++++  el  t++
  Rsa1.0_03244.1_g00001.1 291 SELSPVLQFANFTSNQALLESFHGFNRLHIIDFDIGFGGQWASLMQELVlLRDnnnndSPRPlSLKITLLAS-SHDNDLELGFTQD 375
                              *************************************************77776654434556*********.7789********* PP

                     GRAS 164 rLakfAeelgvpfefnvlvakrledleleeLrvkp...gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqea 246
                              +L++fA+e++++++++vl   +l+ l    L++ p   +Ea+aVnl+ + ++        +s    +L++vk+lsP+++v++++ +
  Rsa1.0_03244.1_g00001.1 376 NLKHFASEINISLDIQVL---TLDLL----LSFPPpneKEAVAVNLSPSSFSNT------PS---LLLRFVKHLSPTIIVCSDRGC 445
                              *****************8...66666....55555556********99665554......55...89******************* PP

                     GRAS 247 dhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhet..lekWrerleeaGFkpvpls 330
                              ++++ +F +++l++l+ ++al++sl+a   +  ++++k+Er+l+++ei+++v  + +++r   e+  +++W+++++++GF+pv+ s
  Rsa1.0_03244.1_g00001.1 446 ERTDLPFPQQLLHSLQSHAALLESLDAV-NASLDAMQKIERFLVQPEIEKLVLDRSSSSRRPVERpmMMTWQAMFMQMGFSPVAHS 530
                              *************************887.34559*******************9988855544432289***************** PP

                     GRAS 331 ekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              +++++qa++l+++++++g++ve++++sl+l+W++r+Lv vSaWr
  Rsa1.0_03244.1_g00001.1 531 NFTESQAECLVQRTPVRGFHVEKKHNSLLLCWQRRELVGVSAWR 574
                              *******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.215182554IPR005202Transcription factor GRAS
PfamPF035146.5E-92208574IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MPLPSFEEFQ GKVISSYFSS SDIEPTSVLS PLTTSSSTVS SSHGVNTAVG GSGGVSTAIS  60
GGGDEQCGGS DWEQVLPPAS PTHDHDNDQS ILRLIMMGDS QEDPSHELNN ILQTSSASQS  120
PVTFHHSDYT SLGTSFGVLD NTTGVFGSVP PLFQSQVVEE KPPPHPLLIN QSQTHFTQQP  180
SLFYGHHHTL PPPAKRLNQG SLNQGTLTEQ LFKVAEVIES GGDTCLAQGI LARLNQQLSS  240
PAAGKPFERA ASYFIEALHS CLLHHNNATQ QQPLLNPYSL IFKISAYKSF SELSPVLQFA  300
NFTSNQALLE SFHGFNRLHI IDFDIGFGGQ WASLMQELVL LRDNNNNDSP RPLSLKITLL  360
ASSHDNDLEL GFTQDNLKHF ASEINISLDI QVLTLDLLLS FPPPNEKEAV AVNLSPSSFS  420
NTPSLLLRFV KHLSPTIIVC SDRGCERTDL PFPQQLLHSL QSHAALLESL DAVNASLDAM  480
QKIERFLVQP EIEKLVLDRS SSSRRPVERP MMMTWQAMFM QMGFSPVAHS NFTESQAECL  540
VQRTPVRGFH VEKKHNSLLL CWQRRELVGV SAWRCRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-2424357436375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009111514.10.0PREDICTED: scarecrow-like protein 6
RefseqXP_013697066.10.0PREDICTED: scarecrow-like protein 6
SwissprotO813160.0SCL6_ARATH; Scarecrow-like protein 6
TrEMBLM4F8A70.0M4F8A7_BRARP; Uncharacterized protein
STRINGBra037319.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85742739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.10.0GRAS family protein